About 14 results
- Northern krillLearn more:✕This summary was generated using AI based on multiple online sources. To view the original source information, use the "Learn more" links.Northern krill (Meganyctiphanes norvegica) is a species of krill that lives in the North Atlantic Ocean. It is an important component of the zooplankton, providing food for whales, seals, fish and birds. (In the Southern Ocean, Antarctic krill Euphausia superba fills a similar role.)en.wikipedia.org/wiki/Northern_krillMeganyctiphanes norvegica (M. Sars, 1857) A large, subarctic Atlantic krill, maringally present in the Arcticwww.arcodiv.org/watercolumn/euphausiid/Megany…
Fin whale - Wikipedia
VDWHV LGHQWLILFDWLRQRIELRDFWLYHSHSWLGHVIURP …
List of Latin and Greek words commonly used in systematic names
Living at depth: ecophysiological condition of Boreomysis arctica …
Marine Species Traits
BilginCin
ICES Reference Codes - RECO
#собаки | Интересный контент в группе Наши забавные …
TUBB3 antibody | 66 products in Validated Antibody Database; …
P:Mar - fr-academic.com
Related searches for "Meganyctiphanes norvegica"